Pairwise Sequence Alignment¶
UniProt¶
In the previous chapter you learnt how to retrieve DNA and protein sequences from the NCBI database. The NCBI database is a key database in bioinformatics because it contains essentially all DNA sequences ever sequenced.
As mentioned in the previous chapter, a subsection of the NCBI database called RefSeq consists of high quality DNA and protein sequence data. Furthermore, the NCBI entries for the RefSeq sequences have been manually curated, which means that biologists employed by NCBI have added additional information to the NCBI entries for those sequences, such as details of scientific papers that describe the sequences.
Another extremely important manually curated database is UniProt (www.uniprot.org), which focuses on protein sequences. UniProt aims to contains manually curated information on all known protein sequences. While many of the protein sequences in UniProt are also present in RefSeq, the amount and quality of manually curated information in UniProt is much higher than that in RefSeq.
For each protein in UniProt, the UniProt curators read all the scientific papers that they can find about that protein, and add information from those papers to the protein’s UniProt entry. For example, for a human protein, the UniProt entry for the protein usually includes information about the biological function of the protein, in what human tissues it is expressed, whether it interacts with other human proteins, and much more. All this information has been manually gathered by the UniProt curators from scientific papers, and the papers in which the found the information are always listed in the UniProt entry for the protein.
Just like NCBI, UniProt also assigns an accession to each sequence in the UniProt database. Although the same protein sequence may appear in both the NCBI database and the UniProt database, it will have different NCBI and UniProt accessions. However, there is usually a link on the NCBI entry for the protein sequence to the UniProt entry, and vice versa.
Viewing the UniProt webpage for a protein sequence¶
If you are given the UniProt accession for a protein, to find the UniProt entry for the protein, you first need to go the UniProt website, www.uniprot.org. At the top of the UniProt website, you will see a search box, and you can type the accession of the protein that you are looking for in this search box, and then click on the “Search” button to search for it.
For example, if you want to find the sequence for the chorismate lyase protein from Mycobacterium leprae (the bacterium which causes leprosy), which has UniProt accession Q9CD83, you would type just “Q9CD83” in the search box and press “Search”:
The UniProt entry for UniProt accession Q9CD83 will then appear in your web browser. The picture below shows the top part of the UniProt entry for accession Q9CD83. You can see there is a lot of information about the protein in its UniProt entry.
Beside the heading “Organism” you can see the organism is given as Mycobacterium leprae. Beside the heading “Taxonomic lineage”, you can see “Bacteria > Actinobacteria > Actinobacteridae > Actinomycetales > Corynebacterineae > Mycobacteriaceae > Mycobacterium”.
This tells us that Mycobacterium is a species of bacteria, which belongs to a group of related bacteria called the Mycobacteriaceae, which itself belongs to a larger group of related bacteria called the Corynebacterineae, which itself belongs to an even larger group of related bacteria called the Actinomycetales, which itself belongs to the Actinobacteridae, which itself belongs to a huge group of bacteria called the Actinobacteria.
Beside the heading “Sequence length” we see that the sequence is 210 amino acids long (210 letters long). Further down, beside the heading “Function”, it says that the function of this protein is that it “Removes the pyruvyl group from chorismate to provide 4-hydroxybenzoate (4HB)”. This tells us this protein is an enzyme (a protein that increases the rate of a specific biochemical reaction), and tells us what is the particular biochemical reaction that this enzyme is involved in.
Further down the UniProt page for this protein, you will see a lot more information, as well as many links to webpages in other biological databases, such as NCBI. The huge amount of information about proteins in UniProt means that if you want to find out about a particular protein, the UniProt page for that protein is a great place to start.
Retrieving a UniProt protein sequence via the UniProt website¶
To retrieve a FASTA-format file containing the sequence for a particular protein, you need to look at the top right of the UniProt entry for the protein on the UniProt website.
You will see a small orange button labelled “FASTA”, which you should click on:
The FASTA-format sequence for the accession will now appear in your web browser. To save it as a file, go to the “File” menu of your web browser, choose “Save page as”, and save the file. Remember to give the file a sensible name (eg. “Q9CD83.fasta” for accession Q9CD83), and in a place that you will remember (eg. in the “My Documents” folder).
For example, you can retrieve the protein sequences for the chorismate lyase protein from Mycobacterium leprae (which has UniProt accession Q9CD83) and for the chorismate lyase protein from Mycobacterium ulcerans (UniProt accession A0PQ23), and save them as FASTA-format files (eg. “Q9CD83.fasta” and “A0PQ23.fasta”, as described above.
Note that Mycobacterium leprae is the bacterium which causes leprosy, while Mycobacterium ulcerans is a related bacterium which causes Buruli ulcer, both of which are classified by the WHO as neglected tropical diseases.
Note that the M. leprae and M. ulcerans chorismate lyase proteins are an example of a pair of homologous (related) proteins in two related species of bacteria.
Once you have downloaded the protein sequences for UniProt accessions Q9CD83 and A0PQ23 and saved them as FASTA-format files (eg. “Q9CD83.fasta” and “A0PQ23.fasta”), you can read them into R using the read.fasta() function in the SeqinR R package (as described in chapter 1).
Remember that the read.fasta() function expects that you have put your FASTA-format files in the “My Documents” folder on your computer.
For example, the following commands will read the FASTA-format files Q9CD83.fasta and A0PQ23.fasta into R, and store the two protein sequences in two vectors lepraeseq and ulceransseq:
> library("seqinr")
> leprae <- read.fasta(file = "Q9CD83.fasta")
> ulcerans <- read.fasta(file = "A0PQ23.fasta")
> lepraeseq <- leprae[[1]]
> ulceransseq <- ulcerans[[1]]
> lepraeseq # Display the contents of the vector "lepraeseq"
[1] "m" "t" "n" "r" "t" "l" "s" "r" "e" "e" "i" "r" "k" "l" "d" "r" "d" "l"
[19] "r" "i" "l" "v" "a" "t" "n" "g" "t" "l" "t" "r" "v" "l" "n" "v" "v" "a"
[37] "n" "e" "e" "i" "v" "v" "d" "i" "i" "n" "q" "q" "l" "l" "d" "v" "a" "p"
[55] "k" "i" "p" "e" "l" "e" "n" "l" "k" "i" "g" "r" "i" "l" "q" "r" "d" "i"
[73] "l" "l" "k" "g" "q" "k" "s" "g" "i" "l" "f" "v" "a" "a" "e" "s" "l" "i"
[91] "v" "i" "d" "l" "l" "p" "t" "a" "i" "t" "t" "y" "l" "t" "k" "t" "h" "h"
[109] "p" "i" "g" "e" "i" "m" "a" "a" "s" "r" "i" "e" "t" "y" "k" "e" "d" "a"
[127] "q" "v" "w" "i" "g" "d" "l" "p" "c" "w" "l" "a" "d" "y" "g" "y" "w" "d"
[145] "l" "p" "k" "r" "a" "v" "g" "r" "r" "y" "r" "i" "i" "a" "g" "g" "q" "p"
[163] "v" "i" "i" "t" "t" "e" "y" "f" "l" "r" "s" "v" "f" "q" "d" "t" "p" "r"
[181] "e" "e" "l" "d" "r" "c" "q" "y" "s" "n" "d" "i" "d" "t" "r" "s" "g" "d"
[199] "r" "f" "v" "l" "h" "g" "r" "v" "f" "k" "n" "l"
Retrieving a UniProt protein sequence using SeqinR¶
An alternative method of retrieving a UniProt protein sequence is to use the SeqinR package to query the ACNUC sub-database “swissprot”, which contains protein sequences from UniProt.
We use the query() function from SeqinR to query this database, as described in chapter3.
For example to retrieve the protein sequences for UniProt accessions Q9CD83 and A0PQ23, we type in R:
> library("seqinr")
> choosebank("swissprot")
> query("leprae", "AC=Q9CD83")
> lepraeseq <- getSequence(leprae$req[[1]])
> query("ulcerans", "AC=A0PQ23")
> ulceransseq <- getSequence(ulcerans$req[[1]])
> closebank()
> lepraeseq # Display the contents of "lepraeseq"
[1] "M" "T" "N" "R" "T" "L" "S" "R" "E" "E" "I" "R" "K" "L" "D" "R" "D" "L"
[19] "R" "I" "L" "V" "A" "T" "N" "G" "T" "L" "T" "R" "V" "L" "N" "V" "V" "A"
[37] "N" "E" "E" "I" "V" "V" "D" "I" "I" "N" "Q" "Q" "L" "L" "D" "V" "A" "P"
[55] "K" "I" "P" "E" "L" "E" "N" "L" "K" "I" "G" "R" "I" "L" "Q" "R" "D" "I"
[73] "L" "L" "K" "G" "Q" "K" "S" "G" "I" "L" "F" "V" "A" "A" "E" "S" "L" "I"
[91] "V" "I" "D" "L" "L" "P" "T" "A" "I" "T" "T" "Y" "L" "T" "K" "T" "H" "H"
[109] "P" "I" "G" "E" "I" "M" "A" "A" "S" "R" "I" "E" "T" "Y" "K" "E" "D" "A"
[127] "Q" "V" "W" "I" "G" "D" "L" "P" "C" "W" "L" "A" "D" "Y" "G" "Y" "W" "D"
[145] "L" "P" "K" "R" "A" "V" "G" "R" "R" "Y" "R" "I" "I" "A" "G" "G" "Q" "P"
[163] "V" "I" "I" "T" "T" "E" "Y" "F" "L" "R" "S" "V" "F" "Q" "D" "T" "P" "R"
[181] "E" "E" "L" "D" "R" "C" "Q" "Y" "S" "N" "D" "I" "D" "T" "R" "S" "G" "D"
[199] "R" "F" "V" "L" "H" "G" "R" "V" "F" "K" "N" "L"
Comparing two sequences using a dotplot¶
As a first step in comparing two protein, RNA or DNA sequences, it is a good idea to make a dotplot. A dotplot is a graphical method that allows the comparison of two protein or DNA sequences and identify regions of close similarity between them. A dotplot is essentially a two-dimensional matrix (like a grid), which has the sequences of the proteins being compared along the vertical and horizontal axes.
In order to make a simple dotplot to represent of the similarity between two sequences, individual cells in the matrix can be shaded black if residues are identical, so that matching sequence segments appear as runs of diagonal lines across the matrix. Identical proteins will have a line exactly on the main diagonal of the dotplot, that spans across the whole matrix.
For proteins that are not identical, but share regions of similarity, the dotplot will have shorter lines that may be on the main diagonal, or off the main diagonal of the matrix. In essence, a dotplot will reveal if there are any regions that are clearly very similar in two protein (or DNA) sequences.
We can create a dotplot for two sequences using the “dotPlot()” function in the SeqinR R package.
For example, if we want to create a dotplot of the sequences for the chorismate lyase proteins from Mycobacterium leprae and Mycobacterium ulcerans, we would type:
> dotPlot(lepraeseq, ulceransseq)
In the dotplot above, the M. leprae sequence is plotted along the x-axis (horizontal axis), and the M. ulcerans sequence is plotted along the y-axis (vertical axis). The dotplot displays a dot at points where there is an identical amino acid in the two sequences.
For example, if amino acid 53 in the M. leprae sequence is the same amino acid (eg. “W”) as amino acid 70 in the M. ulcerans sequence, then the dotplot will show a dot the position in the plot where x =50 and y =53.
In this case you can see a lot of dots along a diagonal line, which indicates that the two protein sequences contain many identical amino acids at the same (or very similar) positions along their lengths. This is what you would expect, because we know that these two proteins are homologues (related proteins).
Pairwise global alignment of DNA sequences using the Needleman-Wunsch algorithm¶
If you are studying a particular pair of genes or proteins, an important question is to what extent the two sequences are similar.
To quantify similarity, it is necessary to align the two sequences, and then you can calculate a similarity score based on the alignment.
There are two types of alignment in general. A global alignment is an alignment of the full length of two sequences, for example, of two protein sequences or of two DNA sequences. A local alignment is an alignment of part of one sequence to part of another sequence.
The first step in computing a alignment (global or local) is to decide on a scoring system. For example, we may decide to give a score of +2 to a match and a penalty of -1 to a mismatch, and a penalty of -2 to a gap. Thus, for the alignment:
G A A T T C
G A T T - A
we would compute a score of 2 + 2 -1 + 2 -2 - 1 = 2. Similarly, the score for the following alignment is 2 + 2 -2 + 2 + 2 -1 = 5:
G A A T T C
G A - T T A
The scoring system above can be represented by a scoring matrix (also known as a substitution matrix). The scoring matrix has one row and one column for each possible letter in our alphabet of letters (eg. 4 rows and 4 columns for DNA sequences). The (i,j) element of the matrix has a value of +2 in case of a match and -1 in case of a mismatch.
We can make a scoring matrix in R by using the nucleotideSubstitutionMatrix() function in the Biostrings() package. The Biostrings package is part of a set of R packages for bioinformatics analysis known as Bioconductor (www.bioconductor.org/).
To use the Biostrings package, you will first need to install the package (see the instructions here).
The arguments (inputs) for the nucleotideSubstitutionMatrix() function are the score that we want to assign to a match and the score that we want to assign to a mismatch. We can also specify that we want to use only the four letters representing the four nucleotides (ie. A, C, G, T) by setting ‘baseOnly=TRUE’, or whether we also want to use the letters that represent ambiguous cases where we are not sure what the nucleotide is (eg. ‘N’ = A/C/G/T).
To make a scoring matrix which assigns a score of +2 to a match and -1 to a mismatch, and store it in the variable sigma, we type:
> library(Biostrings)
> sigma <- nucleotideSubstitutionMatrix(match = 2, mismatch = -1, baseOnly = TRUE)
> sigma # Print out the matrix
A C G T
A 2 -1 -1 -1
C -1 2 -1 -1
G -1 -1 2 -1
T -1 -1 -1 2
Instead of assigning the same penalty (eg. -8) to every gap position, it is common instead to assign a gap opening penalty to the first position in a gap (eg. -8), and a smaller gap extension penalty to every subsequent position in the same gap.
The reason for doing this is that it is likely that adjacent gap positions were created by the same insertion or deletion event, rather than by several independent insertion or deletion events. Therefore, we don’t want to penalise a 3-letter gap as much as we would penalise three separate 1-letter gaps, as the 3-letter gap may have arisen due to just one insertion or deletion event, while the 3 separate 1-letter gaps probably arose due to three independent insertion or deletion events.
For example, if we want to compute the score for a global alignment of two short DNA sequences ‘GAATTC’ and ‘GATTA’, we can use the Needleman-Wunsch algorithm to calculate the highest-scoring alignment using a particular scoring function.
The “pairwiseAlignment()” function in the Biostrings R package finds the score for the optimal global alignment between two sequences using the Needleman-Wunsch algorithm, given a particular scoring system.
As arguments (inputs), the pairwiseAlignment() function takes the two sequences that you want to align, the scoring matrix, the gap opening penalty, and the gap extension penalty. You can also tell the function that you want to just have the optimal global alignment’s score by setting “scoreOnly = TRUE”, or that you want to have both the optimal global alignment and its score by setting “scoreOnly = FALSE”.
For example, to find the score for the optimal global alignment between the sequences ‘GAATTC’ and ‘GATTA’, we type:
> s1 <- "GAATTC"
> s2 <- "GATTA"
> globalAligns1s2 <- pairwiseAlignment(s1, s2, substitutionMatrix = sigma, gapOpening = -2,
gapExtension = -8, scoreOnly = FALSE)
> globalAligns1s2 # Print out the optimal alignment and its score
Global Pairwise Alignment (1 of 1)
pattern: [1] GAATTC
subject: [1] GA-TTA
score: -3
The above commands print out the optimal global alignment for the two sequences and its score.
Note that we set “gapOpening” to be -2 and “gapExtension” to be -8, which means that the first position of a gap is assigned a score of (-8-2=)-10, and every subsequent position in a gap is given a score of -8. Here the alignment contains four matches, one mismatch, and one gap of length 1, so its score is (4*2)+(1*-1)+(1*-10) = -3.
Pairwise global alignment of protein sequences using the Needleman-Wunsch algorithm¶
As well as DNA alignments, it is also possible to make alignments of protein sequences. In this case it is necessary to use a scoring matrix for amino acids rather than for nucleotides.
There are several well known scoring matrices that come with R, such as the BLOSUM series of matrices. Different BLOSUM matrices exist, named with different numbers. BLOSUM with high numbers are designed for comparing closely related sequences, while BLOSUM with low numbers are designed for comparing distantly related sequences. For example, BLOSUM62 is used for less divergent alignments (alignments of sequences that differ little), and BLOSUM30 is used for more divergent alignments (alignments of sequences that differ a lot).
Many R packages come with example data sets or data files. The “data()” function is used to load these data files. You can use the data() function in R to load a data set of BLOSUM matrices that comes with R Biostrings() package.
To load the BLOSUM50 matrix, we type:
> data(BLOSUM50)
> BLOSUM50 # Print out the data
A R N D C Q E G H I L K M F P S T W Y V B Z X *
A 5 -2 -1 -2 -1 -1 -1 0 -2 -1 -2 -1 -1 -3 -1 1 0 -3 -2 0 -2 -1 -1 -5
R -2 7 -1 -2 -4 1 0 -3 0 -4 -3 3 -2 -3 -3 -1 -1 -3 -1 -3 -1 0 -1 -5
N -1 -1 7 2 -2 0 0 0 1 -3 -4 0 -2 -4 -2 1 0 -4 -2 -3 4 0 -1 -5
D -2 -2 2 8 -4 0 2 -1 -1 -4 -4 -1 -4 -5 -1 0 -1 -5 -3 -4 5 1 -1 -5
C -1 -4 -2 -4 13 -3 -3 -3 -3 -2 -2 -3 -2 -2 -4 -1 -1 -5 -3 -1 -3 -3 -2 -5
Q -1 1 0 0 -3 7 2 -2 1 -3 -2 2 0 -4 -1 0 -1 -1 -1 -3 0 4 -1 -5
E -1 0 0 2 -3 2 6 -3 0 -4 -3 1 -2 -3 -1 -1 -1 -3 -2 -3 1 5 -1 -5
G 0 -3 0 -1 -3 -2 -3 8 -2 -4 -4 -2 -3 -4 -2 0 -2 -3 -3 -4 -1 -2 -2 -5
H -2 0 1 -1 -3 1 0 -2 10 -4 -3 0 -1 -1 -2 -1 -2 -3 2 -4 0 0 -1 -5
I -1 -4 -3 -4 -2 -3 -4 -4 -4 5 2 -3 2 0 -3 -3 -1 -3 -1 4 -4 -3 -1 -5
L -2 -3 -4 -4 -2 -2 -3 -4 -3 2 5 -3 3 1 -4 -3 -1 -2 -1 1 -4 -3 -1 -5
K -1 3 0 -1 -3 2 1 -2 0 -3 -3 6 -2 -4 -1 0 -1 -3 -2 -3 0 1 -1 -5
M -1 -2 -2 -4 -2 0 -2 -3 -1 2 3 -2 7 0 -3 -2 -1 -1 0 1 -3 -1 -1 -5
F -3 -3 -4 -5 -2 -4 -3 -4 -1 0 1 -4 0 8 -4 -3 -2 1 4 -1 -4 -4 -2 -5
P -1 -3 -2 -1 -4 -1 -1 -2 -2 -3 -4 -1 -3 -4 10 -1 -1 -4 -3 -3 -2 -1 -2 -5
S 1 -1 1 0 -1 0 -1 0 -1 -3 -3 0 -2 -3 -1 5 2 -4 -2 -2 0 0 -1 -5
T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 2 5 -3 -2 0 0 -1 0 -5
W -3 -3 -4 -5 -5 -1 -3 -3 -3 -3 -2 -3 -1 1 -4 -4 -3 15 2 -3 -5 -2 -3 -5
Y -2 -1 -2 -3 -3 -1 -2 -3 2 -1 -1 -2 0 4 -3 -2 -2 2 8 -1 -3 -2 -1 -5
V 0 -3 -3 -4 -1 -3 -3 -4 -4 4 1 -3 1 -1 -3 -2 0 -3 -1 5 -4 -3 -1 -5
B -2 -1 4 5 -3 0 1 -1 0 -4 -4 0 -3 -4 -2 0 0 -5 -3 -4 5 2 -1 -5
Z -1 0 0 1 -3 4 5 -2 0 -3 -3 1 -1 -4 -1 0 -1 -2 -2 -3 2 5 -1 -5
X -1 -1 -1 -1 -2 -1 -1 -2 -1 -1 -1 -1 -1 -2 -2 -1 0 -3 -1 -1 -1 -1 -1 -5
* -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 1
You can get a list of the available scoring matrices that come with the Biostrings package by using the data() function, which takes as an argument the name of the package for which you want to know the data sets that come with it:
> data(package="Biostrings")
Data sets in package 'Biostring':
BLOSUM100 Scoring matrices
BLOSUM45 Scoring matrices
BLOSUM50 Scoring matrices
BLOSUM62 Scoring matrices
BLOSUM80 Scoring matrices
To find the optimal global alignment between the protein sequences “PAWHEAE” and “HEAGAWGHEE” using the Needleman-Wunsch algorithm using the BLOSUM50 matrix, we type:
> data(BLOSUM50)
> s3 <- "PAWHEAE"
> s4 <- "HEAGAWGHEE"
> globalAligns3s4 <- pairwiseAlignment(s3, s4, substitutionMatrix = "BLOSUM50", gapOpening = -2,
gapExtension = -8, scoreOnly = FALSE)
> globalAligns3s4 # Print out the optimal global alignment and its score
Global Pairwise Alignment (1 of 1)
pattern: [1] P---AWHEAE
subject: [1] HEAGAWGHEE
score: -5
We set “gapOpening” to be -2 and “gapExtension” to be -8, which means that the first position of a gap is assigned a score of (-8-2=)-10, and every subsequent position in a gap is given a score of -8. This means that the gap will be given a score of -10-8-8 = -26.
Aligning UniProt sequences¶
We discussed above how you can search for UniProt accessions and retrieve the corresponding protein sequences, either via the UniProt website or using the SeqinR R package.
In the examples given above, you learnt how to retrieve the sequences for the chorismate lyase proteins from Mycobacterium leprae (UniProt Q9CD83) and Mycobacterium ulcerans (UniProt A0PQ23), and read them into R, and store them as vectors lepraeseq and ulceransseq.
You can align these sequences using pairwiseAlignment() from the Biostrings package.
As its input, the pairwiseAlignment() function requires that the sequences be in the form of a single string (eg. “ACGTA”), rather than as a vector of characters (eg. a vector with the first element as “A”, the second element as “C”, etc.). Therefore, to align the M. leprae and M. ulcerans chorismate lyase proteins, we first need to convert the vectors lepraeeq and ulceransseq into strings. We can do this using the c2s() function in the SeqinR package:
> lepraeseqstring <- c2s(lepraeseq) # Make a string that contains the sequence in "lepraeseq"
> ulceransseqstring <- c2s(ulceransseq) # Make a string that contains the sequence in "ulceransseq"
Furthermore, pairwiseAlignment() requires that the sequences be stored as uppercase characters. Therefore, if they are not already in uppercase, we need to use the toupper() function to convert lepraeseqstring and ulceransseqstring to uppercase:
> lepraeseqstring <- toupper(lepraeseqstring)
> ulceransseqstring <- toupper(ulceransseqstring)
> lepraeseqstring # Print out the content of "lepraeseqstring"
[1] "MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKNL"
We can now align the the M. leprae and M. ulcerans chorismate lyase protein sequences using the pairwiseAlignment() function:
> globalAlignLepraeUlcerans <- pairwiseAlignment(lepraeseqstring, ulceransseqstring,
substitutionMatrix = BLOSUM50, gapOpening = -2, gapExtension = -8, scoreOnly = FALSE)
> globalAlignLepraeUlcerans # Print out the optimal global alignment and its score
Global PairwiseAlignedFixedSubject (1 of 1)
pattern: [1] MT-----NR--T---LSREEIRKLDRDLRILVATN...QDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKN
subject: [1] MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATN...EDNSREEPIRHQRS--VGT-SA-R---SGRSICT
score: 627
As the alignment is very long, when you type globalAlignLepraeUlcerans, you only see the start and the end of the alignment (see above). Therefore, we need to have a function to print out the whole alignment (see below).
Viewing a long pairwise alignment¶
If you want to view a long pairwise alignment such as that between the M. leprae and M. ulerans chorismate lyase proteins, it is convenient to print out the alignment in blocks.
The R function “printPairwiseAlignment()” below will do this for you:
> printPairwiseAlignment <- function(alignment, chunksize=60, returnlist=FALSE)
{
require(Biostrings) # This function requires the Biostrings package
seq1aln <- pattern(alignment) # Get the alignment for the first sequence
seq2aln <- subject(alignment) # Get the alignment for the second sequence
alnlen <- nchar(seq1aln) # Find the number of columns in the alignment
starts <- seq(1, alnlen, by=chunksize)
n <- length(starts)
seq1alnresidues <- 0
seq2alnresidues <- 0
for (i in 1:n) {
chunkseq1aln <- substring(seq1aln, starts[i], starts[i]+chunksize-1)
chunkseq2aln <- substring(seq2aln, starts[i], starts[i]+chunksize-1)
# Find out how many gaps there are in chunkseq1aln:
gaps1 <- countPattern("-",chunkseq1aln) # countPattern() is from Biostrings package
# Find out how many gaps there are in chunkseq2aln:
gaps2 <- countPattern("-",chunkseq2aln) # countPattern() is from Biostrings package
# Calculate how many residues of the first sequence we have printed so far in the alignment:
seq1alnresidues <- seq1alnresidues + chunksize - gaps1
# Calculate how many residues of the second sequence we have printed so far in the alignment:
seq2alnresidues <- seq2alnresidues + chunksize - gaps2
if (returnlist == 'FALSE')
{
print(paste(chunkseq1aln,seq1alnresidues))
print(paste(chunkseq2aln,seq2alnresidues))
print(paste(' '))
}
}
if (returnlist == 'TRUE')
{
vector1 <- s2c(substring(seq1aln, 1, nchar(seq1aln)))
vector2 <- s2c(substring(seq2aln, 1, nchar(seq2aln)))
mylist <- list(vector1, vector2)
return(mylist)
}
}
To use this function you first need to copy and paste this function into R. You can then use our function printPairwiseAlignment() to print out the alignment between the M. leprae and M. ulcerans chorismate lyase proteins (we stored this alignment in the globalAlignLepraeUlcerans variable, see above), in blocks of 60 alignment columns:
> printPairwiseAlignment(globalAlignLepraeUlcerans, 60)
[1] "MT-----NR--T---LSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLL 50"
[1] "MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQ 60"
[1] " "
[1] "DVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPI 110"
[1] "DAAPEMDGCDHSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPI 120"
[1] " "
[1] "GEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYF 170"
[1] "GEVMAASCIETFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYF 180"
[1] " "
[1] "LRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKN 230"
[1] "LRSVFEDNSREEPIRHQRS--VGT-SA-R---SGRSICT 233"
[1] " "
The position in the protein of the amino acid that is at the end of each line of the printed alignment is shown after the end of the line. For example, the first line of the alignment above finishes at amino acid position 50 in the M. leprae protein and also at amino acid position 60 in the M. ulcerans protein.
Since we are printing out an alignment that contained gaps in the first 60 alignment columns, the first 60 alignment columns ends before the 60th amino acid in the M. leprae sequence.
Pairwise local alignment of protein sequences using the Smith-Waterman algorithm¶
You can use the pairwiseAlignment() function to find the optimal local alignment of two sequences, that is the best alignment of parts (subsequences) of those sequences, by using the “type=local” argument in pairwiseAlignment(). This uses the Smith-Waterman algorithm for local alignment, the classic bioinformatics algorithm for finding optimal local alignments.
For example, to find the best local alignment between the M. leprae and M. ulcerans chorismate lyase proteins, we can type:
> localAlignLepraeUlcerans <- pairwiseAlignment(lepraeseqstring, ulceransseqstring,
substitutionMatrix = BLOSUM50, gapOpening = -2, gapExtension = -8, scoreOnly = FALSE, type="local")
> localAlignLepraeUlcerans # Print out the optimal local alignment and its score
Local PairwiseAlignedFixedSubject (1 of 1)
pattern: [1] MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVV...IITTEYFLRSVFQDTPREELDRCQYSNDIDTRSG
subject: [11] MTECHLSDEEIRKLNRDLRILIATNGTLTRILNVL...IIITEYFLRSVFEDNSREEPIRHQRSVGTSARSG
score: 761
> printPairwiseAlignment(localAlignLepraeUlcerans, 60)
[1] "MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELE 60"
[1] "MTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQDAAPEMDGCD 60"
[1] " "
[1] "NLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIE 120"
[1] "HSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPIGEVMAASCIE 120"
[1] " "
[1] "TYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPR 180"
[1] "TFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYFLRSVFEDNSR 180"
[1] " "
[1] "EELDRCQYSNDIDTRSG 240"
[1] "EEPIRHQRSVGTSARSG 240"
[1] " "
We see that the optimal local alignment is quite similar to the optimal global alignment in this case, except that it excludes a short region of poorly aligned sequence at the start and at the ends of the two proteins.
Calculating the statistical significance of a pairwise global alignment¶
We have seen that when we align the ‘PAWHEAE’ and ‘HEAGAWGHEE’ protein sequences, they have some similarity, and the score for their optimal global alignment is -5.
But is this alignment statistically significant? In other words, is this alignment better than we would expect between any two random proteins?
The Needleman-Wunsch alignment algorithm will produce a global alignment even if we give it two unrelated random protein sequences, although the alignment score would be low.
Therefore, we should ask: is the score for our alignment better than expected between two random sequences of the same lengths and amino acid compositions?
It is reasonable to expect that if the alignment score is statistically significant, then it will be higher than the scores obtained from aligning pairs of random protein sequences that have the same lengths and amino acid compositions as our original two sequences.
Therefore, to assess if the score for our alignment between the ‘PAWHEAE’ and ‘HEAGAWGHEE’ protein sequence is statistically significant, a first step is to make some random sequences that have the same amino acid composition and length as one of our initial two sequences, for example, as the same amino acid composition and length as the sequence ‘PAWHEAE’.
How can we obtain random sequences of the same amino acid composition and length as the sequence ‘PAWHEAE’? One way is to generate sequences using a multinomial model for protein sequences in which the probabilities of the different amino acids set to be equal to their frequencies in the sequence ‘PAWHEAE’.
That is, we can generate sequences using a multinomial model for proteins, in which the probability of ‘P’ is set to 0.1428571 (1/7); the probability of ‘A’ is set to 0.2857143 (2/7); the probability of ‘W’ is set to 0.1428571 (1/7); the probability of ‘H’ is set to 0.1428571 (1/7); and the probabilty of ‘E’ is set to 0.2857143 (2/7), and the probabilities of the other 15 amino acids are set to 0.
To generate a sequence with this multinomial model, we choose the letter for each position in the sequence according to those probabilities. This is as if we have made a roulette wheel in which 1/7*th* of the circle is taken up by a pie labelled “P”, 2/7*ths* by a pie labelled “A”, 1/7*th* by a pie labelled “W”, 1/7*th* by a pie labelled “H”, and 2/7*ths* by a pie labelled “E”:
To generate a sequence using the multinomial model, we keep spinning the arrow in the centre of the roulette wheel, and write down the letter that the arrow stops on after each spin. To generate a sequence that is 7 letters long, we can spin the arrow 7 times. To generate 1000 sequences that are each 7 letters long, we can spin the arrow 7000 times, where the letters chosen form 1000 7-letter amino acid sequences.
To generate a certain number (eg.1000) random amino acid sequences of a certain length using a multinomial model, you can use the function generateSeqsWithMultinomialModel() below:
> generateSeqsWithMultinomialModel <- function(inputsequence, X)
{
# Change the input sequence into a vector of letters
require("seqinr") # This function requires the SeqinR package.
inputsequencevector <- s2c(inputsequence)
# Find the frequencies of the letters in the input sequence "inputsequencevector":
mylength <- length(inputsequencevector)
mytable <- table(inputsequencevector)
# Find the names of the letters in the sequence
letters <- rownames(mytable)
numletters <- length(letters)
probabilities <- numeric() # Make a vector to store the probabilities of letters
for (i in 1:numletters)
{
letter <- letters[i]
count <- mytable[[i]]
probabilities[i] <- count/mylength
}
# Make X random sequences using the multinomial model with probabilities "probabilities"
seqs <- numeric(X)
for (j in 1:X)
{
seq <- sample(letters, mylength, rep=TRUE, prob=probabilities) # Sample with replacement
seq <- c2s(seq)
seqs[j] <- seq
}
# Return the vector of random sequences
return(seqs)
}
The function generateSeqsWithMultinomialModel() generates X random sequences with a multinomial model, where the probabilities of the different letters are set equal to their frequencies in an input sequence, which is passed to the function as a string of characters (eg. ‘PAWHEAE’).
The function returns X random sequences in the form of a vector which has X elements, the first element of the vector contains the first sequence, the second element contains the second sequence, and so on.
You will need to copy and paste this function into R before you can use it.
We can use this function to generate 1000 7-letter amino acid sequences using a multinomial model in which the probabilities of the letters are set equal to their frequencies in ‘PAWHEAE’ (ie. probabilities 1/7 for P, 2/7 for A, 1/7 for W, 1/7 for H and 2/7 for E), by typing:
> randomseqs <- generateSeqsWithMultinomialModel('PAWHEAE',1000)
> randomseqs[1:10] # Print out the first 10 random sequences
[1] "EHHEWEA" "EAEEEAH" "WAHAWEP" "PPAPAAW" "HEPWWAA" "APAAAAA" "EAHAPHP"
[8] "AAPEEWE" "HEAAAAP" "EWAAPEP"
The 1000 random sequences are stored in a vector randomseqs that has 1000 elements, each of which contains one of the random sequences.
We can then use the Needleman-Wunsch algorithm to align the sequence ‘HEAGAWGHEE’ to one of the 1000 random sequences generated using the multinomial model with probabilities 1/7 for P, 2/7 for A, 1/7 for W, 1/7 for H and 2/7 for E.
For example, to align ‘HEAGAWGHEE’ to the first of the 1000 random sequences (‘EEHAAAE’), we type:
> s4 <- "HEAGAWGHEE"
> pairwiseAlignment(s4, randomseqs[1], substitutionMatrix = "BLOSUM50", gapOpening = -2,
gapExtension = -8, scoreOnly = FALSE)
Global PairwiseAlignedFixedSubject (1 of 1)
pattern: [2] EAGAWGHEE
subject: [1] EHHEW--EA
score: -7
If we use the pairwiseAlignment() function with the argument ‘scoreOnly=TRUE’, it will just give us the score for the alignment:
> pairwiseAlignment(s4, randomseqs[1], substitutionMatrix = "BLOSUM50", gapOpening = -2,
gapExtension = -8, scoreOnly = TRUE)
[1] -7
If we repeat this 1000 times, that is, for each of the 1000 random sequences in vector randomseqs, we can get a distribution of alignment scores expected for aligning ‘HEAGAWGHEE’ to random sequences of the same length and (approximately the same) amino acid composition as ‘PAWHEAE’.
We can then compare the actual score for aligning ‘PAWHEAE’ to ‘HEAGAWGHEE’ (ie. -5) to the distribution of scores for aligning ‘HEAGAWGHEE’ to the random sequences.
> randomscores <- double(1000) # Create a numeric vector with 1000 elements
> for (i in 1:1000)
{
score <- pairwiseAlignment(s4, randomseqs[i], substitutionMatrix = "BLOSUM50",
gapOpening = -2, gapExtension = -8, scoreOnly = TRUE)
randomscores[i] <- score
}
The code above first uses the double() function to create a numeric vector randomscores for storing real numbers (ie. not integers), with 1000 elements. This will be used to store the alignment scores for 1000 alignments between ‘HEAGAWGHEE’ and the 1000 different random sequences generated using the multinomial model.
The ‘for loop’ takes each of the 1000 different random sequences, aligns each one to ‘HEAGAWGHEE’, and stores the 1000 alignment scores in the randomscores vector.
Once we have run the ‘for loop’, we can make a histogram plot of the 1000 scores in vector randomscores by typing:
> hist(randomscores, col="red") # Draw a red histogram
We can see from the histogram that quite a lot of the random sequences seem to have higher alignment scores than -5 when aligned to ‘HEAGAWGHEE’ (where -5 is the alignment score for ‘PAWHEAE’ and ‘HEAGAWGHEE’).
We can use the vector randomscores of scores for 1000 alignments of random sequences to ‘HEAGAWGHEE’ to calculate the probability of getting a score as large as the real alignment score for ‘PAWHEAE’ and ‘HEAGAWGHEE’ (ie. -5) by chance.
> sum(randomscores >= -5)
[1] 266
We see that 266 of the 1000 alignments of random sequences to ‘HEAGAWGHEE’ had alignment scores that were equal to or greater than -5. Thus, we can estimate that the probability of getting a score as large as the real alignment score by chance is (266/1000 =) 0.266. In other words, we can calculate a P-value of 0.266. This probability or P-value is quite high (almost 30%, or 1 in 3), so we can conclude that it is quite probable that we could get an alignment score as high as -5 by chance alone. This indicates that the sequences ‘HEAGAWGHEE’ and ‘PAWHEAE’ are not more similar than any two random sequences, and so they are probably not related sequences.
Another way of saying this is that the P-value that we calculated is high (0.266), and as a result we conclude that the alignment score for the sequences ‘HEAGAWGHEE’ and ‘PAWHEAE’ is not statistically significant. Generally, if the P-value that we calculate for an alignment of two sequences is >0.05, we conclude that the alignment score is not statistically significant, and that the sequences are probably not related. On the other hand, if the P-value is less than or equal to 0.05, we conclude that the alignment score is statistically significant, and the sequences are very probably related (homologous).
Summary¶
In this practical, you will have learnt to use the following R functions:
- data() for reading in data that comes with an R package
- double() for creating a numeric vector for storing real (non-integer) numbers
- toupper() for converting a string of characters from lowercase to uppercase
All of these functions belong to the standard installation of R.
You have also learnt the following R functions that belong to the bioinformatics packages:
- nucleotideSubstitutionMatrix() in the Biostrings package for making a nucleotide scoring matrix
- pairwiseAlignment() in the Biostrings package for making a global alignment between two sequences
- c2s() in the SeqinR package for converting a sequence stored in a vector to a string of characters
Links and Further Reading¶
Some links are included here for further reading.
For background reading on sequence alignment, it is recommended to read Chapter 3 of Introduction to Computational Genomics: a case studies approach by Cristianini and Hahn (Cambridge University Press; www.computational-genomics.net/book/).
For more in-depth information and more examples on using the SeqinR package for sequence analysis, look at the SeqinR documentation, http://pbil.univ-lyon1.fr/software/seqinr/doc.php?lang=eng.
There is also a very nice chapter on “Analyzing Sequences”, which includes examples of using SeqinR and Biostrings for sequence analysis, as well as details on how to implement algorithms such as Needleman-Wunsch and Smith-Waterman in R yourself, in the book Applied statistics for bioinformatics using R by Krijnen (available online at cran.r-project.org/doc/contrib/Krijnen-IntroBioInfStatistics.pdf).
For a more in-depth introduction to R, a good online tutorial is available on the “Kickstarting R” website, cran.r-project.org/doc/contrib/Lemon-kickstart.
There is another nice (slightly more in-depth) tutorial to R available on the “Introduction to R” website, cran.r-project.org/doc/manuals/R-intro.html.
For more information on and examples using the Biostrings package, see the Biostrings documentation at http://www.bioconductor.org/packages/release/bioc/html/Biostrings.html.
Acknowledgements¶
Many of the ideas for the examples and exercises for this practical were inspired by the Matlab case study on the Eyeless protein (www.computational-genomics.net/case_studies/eyeless_demo.html) from the website that accompanies the book Introduction to Computational Genomics: a case studies approach by Cristianini and Hahn (Cambridge University Press; www.computational-genomics.net/book/).
The examples of DNA sequences and protein sequences to align (‘GAATTC’ and ‘GATTA’, and sequences ‘PAWHEAE’ and ‘HEAGAWGHEE’), as well as some ideas related to finding the statistical significance of a pairwise alignment, were inspired by the chapter on “Analyzing Sequences” in the book Applied statistics for bioinformatics using R by Krijnen (cran.r-project.org/doc/contrib/Krijnen-IntroBioInfStatistics.pdf).
Thank you to Jean Lobry and Simon Penel for helpful advice on using the SeqinR package.
Contact¶
I will be grateful if you will send me (Avril Coghlan) corrections or suggestions for improvements to my email address alc@sanger.ac.uk
License¶
The content in this book is licensed under a Creative Commons Attribution 3.0 License.
Exercises¶
Answer the following questions, using the R package. For each question, please record your answer, and what you typed into R to get this answer.
Model answers to the exercises are given in Answers to the exercises on Sequence Alignment.
- Q1. Download FASTA-format files of the Brugia malayi Vab-3 protein (UniProt accession A8PZ80) and the Loa loa Vab-3 protein (UniProt accession E1FTG0) sequences from UniProt.
- Note: the vab-3 gene of Brugia malayi and the vab-3 gene of Loa loa are related genes that control eye development in these two species. Brugia malayi and Loa loa are both parasitic nematode worms, which both cause filariasis, which is classified by the WHO as a neglected tropical disease.
- Q2. What is the alignment score for the optimal global alignment between the Brugia malayi Vab-3 protein and the Loa loa Vab-3 protein, when you use the BLOSUM50 scoring matrix, a gap opening penalty of -10 and a gap extension penalty of -0.5?
- Note: to specify a gap opening penalty of -10 and a gap extension penalty of -0.5, set the “gapOpening” argument to -9.5, and the “gapExtension” penalty to -0.5 in the pairwiseAlignment() function.
- Q3. Use the printPairwiseAlignment() function to view the optimal global alignment between Brugia malayi Vab-3 protein and the Loa loa Vab-3 protein, using the BLOSUM50 scoring matrix, a gap opening penalty of -10 and a gap extension penalty of -0.5.
- Do you see any regions where the alignment is very good (lots of identities and few gaps)?
- Q4. What global alignment score do you get for the two Vab-3 proteins, when you use the BLOSUM62 alignment matrix, a gap opening penalty of -10 and a gap extension penalty of -0.5?
- Which scoring matrix do you think is more appropriate for using for this pair of proteins: BLOSUM50 or BLOSUM62?
- Q5. What is the statistical significance of the optimal global alignment for the Brugia malayi and Loa loa Vab-3 proteins made using the BLOSUM50 scoring matrix, with a gap opening penalty of -10 and a gap extension penalty of -0.5?
- In other words, what is the probability of getting a score as large as the real alignment score for Vab-3 by chance?
- Q6. What is the optimal global alignment score between the Brugia malayi Vab-6 protein and the Mycobacterium leprae chorismate lyase protein?
- Is the alignment score statistically significant (what is the P- value?)? Does this surprise you?